Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nr2c1 Peptide - N-terminal region

Nr2c1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

4831444H07Rik, 80.3, Eenr, TR2, Tr2-11

UniProt

Q8VIJ4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Nr2c1 Rabbit Polyclonal Antibody (orb576227) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_035759

Preservative

Lyophilized powder

AA Sequence

MATIEEIAHQIIDQQMGEIVTEQQTGQKIQIVTALDHSTQGKQFILANHE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DCAMKL1 (DCLK1) (NM_004734) Human Recombinant Protein
TP317050L 1 mg

DCAMKL1 (DCLK1) (NM_004734) Human Recombinant Protein

Sign In for Pricing
View Details
Tissue FFPE Sections, Joint
CS803179 5x 5 µm

Tissue FFPE Sections, Joint

Sign In for Pricing
View Details
C9 Recombinant Rabbit Monoclonal Antibody [JE01-45]
HA722136 100 µL

C9 Recombinant Rabbit Monoclonal Antibody [JE01-45]

Sign In for Pricing
View Details
Niclosamide
SIH-406-1G 1 g

Niclosamide

Sign In for Pricing
View Details
Tide Fluor™ 7WS, succinimidyl ester [TF7WS SE]*Superior replacement for Cy7*
2333-AAT 1 mg

Tide Fluor™ 7WS, succinimidyl ester [TF7WS SE]*Superior replacement for Cy7*

Sign In for Pricing
View Details
Eph receptor B4 (EPHB4) Rabbit Polyclonal Antibody
AP20388PU-N 100 µg

Eph receptor B4 (EPHB4) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details