Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NUP153 Peptide - C-terminal region

NUP153 Peptide - C-terminal region

Product Specifications

Product Name Alternative

HNUP153, N153

UniProt

P49790

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NUP153 Rabbit Polyclonal Antibody (orb585027) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005115

Preservative

Lyophilized powder

AA Sequence

PKCQPVFSFGNSEQTKDENSSKSTFSFSMTKPSEKESEQPAKATFAFGAQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polyclonal EMA / MUC1 Antibody (C-Terminus)
APR03272G 0.05mg

Polyclonal EMA / MUC1 Antibody (C-Terminus)

Sign In for Pricing
View Details
CHCHD1 Peptide - N-terminal region
MBS3236287-01 0.1 mg

CHCHD1 Peptide - N-terminal region

Sign In for Pricing
View Details
CHCHD1 Peptide - N-terminal region
MBS3236287-02 5x 0.1 mg

CHCHD1 Peptide - N-terminal region

Sign In for Pricing
View Details
Recombinant Escherichia coli Uncharacterized protein ytfB (ytfB)
orb2929076-01 20 µg

Recombinant Escherichia coli Uncharacterized protein ytfB (ytfB)

Sign In for Pricing
View Details
Recombinant Escherichia coli Uncharacterized protein ytfB (ytfB)
orb2929076-02 100 µg

Recombinant Escherichia coli Uncharacterized protein ytfB (ytfB)

Sign In for Pricing
View Details
Human TGF-α ELISA Kit
SEKH-0049-01 48 Tests

Human TGF-α ELISA Kit

Sign In for Pricing
View Details