Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Uncharacterized protein ytfB (ytfB)

This Recombinant Escherichia coli Uncharacterized protein ytfB (ytfB) spans the amino acid sequence from region 1-212.

Product Specifications

Product Name Alternative

Uncharacterized protein ytfB

UniProt

P39310

Expression Region

1-212

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPGRFELKPTLEKVWHAPDNFRFMDPLPPMHRRGIIIAAIVLVVGFLLPSDDTPNAPVVT REAQLDIQSQSQPPTEEQLRAQLVTPQNDPDQVAPVAPEPIQEGQPEEQPQTTQTQPFQP DSGIDNQWRSYRVEPGKTMAQLFRDHGLPATDVYAMAQVEGAGKPLSNLQNGQMVKIRQN ASGVVTGLTIDTGNNQQVLFTRQPDGSFIRAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUDENG Protein Vector (Rat) (pPB-C-His)
PV283710 500 ng

MUDENG Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
Hesperetin
S2308-50mg 50 mg

Hesperetin

Sign In for Pricing
View Details
ACSVL3 Double Nickase Plasmid (h2)
sc-408195-NIC-2 20 µg

ACSVL3 Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
1-Methyl-4-[2- (trimethylsilyl) ethynyl]benzene
OR1092354-01 250 mg

1-Methyl-4-[2- (trimethylsilyl) ethynyl]benzene

Sign In for Pricing
View Details
1-Methyl-4-[2- (trimethylsilyl) ethynyl]benzene
OR1092354-02 500 mg

1-Methyl-4-[2- (trimethylsilyl) ethynyl]benzene

Sign In for Pricing
View Details
1-Methyl-4-[2- (trimethylsilyl) ethynyl]benzene
OR1092354-03 1 g

1-Methyl-4-[2- (trimethylsilyl) ethynyl]benzene

Sign In for Pricing
View Details