PCSK2 Peptide - middle region
PCSK2 Peptide - middle region
Product Specifications
Product Name Alternative
NEC2, PC2, SPC2, NEC 2, NEC-2
UniProt
Q5REC2
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PCSK2 Rabbit Polyclonal Antibody (orb584375) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_002585
Preservative
Lyophilized powder
AA Sequence
LASTFSNGRKRNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
PB10078-HRP 100 µg/Vial
Anti-MPP1 Antibody Picoband® (HRP Conjugate)
Sign In for Pricing
View Details 
MBS1323734-01 0.02 mg (E-Coli)
Recombinant Sulfolobus solfataricus D-tyrosyl-tRNA (Tyr) deacylase (dtdA)
Sign In for Pricing
View Details MBS1323734-02 0.1 mg (E-Coli)
Recombinant Sulfolobus solfataricus D-tyrosyl-tRNA (Tyr) deacylase (dtdA)
Sign In for Pricing
View Details MBS1323734-03 0.02 mg (Yeast)
Recombinant Sulfolobus solfataricus D-tyrosyl-tRNA (Tyr) deacylase (dtdA)
Sign In for Pricing
View Details