Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLEKHA1 Peptide - N-terminal region

PLEKHA1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

TAPP1

UniProt

Q9HB21

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PLEKHA1 Rabbit Polyclonal Antibody (orb583606) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_067635

Preservative

Lyophilized powder

AA Sequence

LNKAIKITVPKQSDSQPNSDNLSRHGECGKKQVSYRTDIVGGVPIITPTQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3 Antibody [17A2]
76-220 0.1 mg

CD3 Antibody [17A2]

Sign In for Pricing
View Details
DARC (CT) (Duffy Antigen/Chemokine Receptor, (Duffy Antigen/Chemokine Receptor, Fy Glycoprotein D, GpFy, Cell Adhesion Molecule 3, CADM3, Plasmodium Vivax Receptor) CCBP1, CD234, CD234 antigen, Dfy, GpFy, Plasmodium vivax receptor) discontinued
D1065-50G 50 µg

DARC (CT) (Duffy Antigen/Chemokine Receptor, (Duffy Antigen/Chemokine Receptor, Fy Glycoprotein D, GpFy, Cell Adhesion Molecule 3, CADM3, Plasmodium Vivax Receptor) CCBP1, CD234, CD234 antigen, Dfy, GpFy, Plasmodium vivax receptor) discontinued

Sign In for Pricing
View Details
Pan Cadherin
E8RE6045 100 µL

Pan Cadherin

Sign In for Pricing
View Details
CD163L1, CT (CD163L1, CD163B, M160, Scavenger receptor cysteine-rich type 1 protein M160, CD163 antigen-like 1, CD163b)
033464 200 µL

CD163L1, CT (CD163L1, CD163B, M160, Scavenger receptor cysteine-rich type 1 protein M160, CD163 antigen-like 1, CD163b)

Sign In for Pricing
View Details
ELISA Kit For Beta-defensin 1
E0352h 96 Tests

ELISA Kit For Beta-defensin 1

Sign In for Pricing
View Details
HUNK CytoSection
TS416803P5 25 Slides

HUNK CytoSection

Sign In for Pricing
View Details