Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLEKHA7 Peptide - middle region

PLEKHA7 Peptide - middle region

Product Specifications

Product Name Alternative

DKFZp686M22243

UniProt

Q6IQ23

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PLEKHA7 Rabbit Polyclonal Antibody (orb582029) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_778228

Preservative

Lyophilized powder

AA Sequence

PESRYQTLPGRGLSGSTSRLQQSSTIAPYVTLRRGLNAESSKATFPRPKS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AMCA Alkyne
507-AAT 1 mg

AMCA Alkyne

Sign In for Pricing
View Details
UNC13A antibody
FNab09255 100 µg

UNC13A antibody

Sign In for Pricing
View Details
Cx40 / GJA5 Recombinant Rabbit monoclonal Antibody
HA723249 100 µL

Cx40 / GJA5 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Nicotinic Acetylcholine Receptor alpha 7 (CHRNA7) Human Gene Knockout Kit (CRISPR)
KN221382 1 Kit

Nicotinic Acetylcholine Receptor alpha 7 (CHRNA7) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GPAT 2 (GPAT2) (NM_207328) Human Over-expression Lysate
LC403722 20 µg

GPAT 2 (GPAT2) (NM_207328) Human Over-expression Lysate

Sign In for Pricing
View Details
Human FNDC10 activation kit by CRISPRa
GA118718 1 Kit

Human FNDC10 activation kit by CRISPRa

Sign In for Pricing
View Details