Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLSCR1 Peptide - N-terminal region

PLSCR1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MMTRA1B

UniProt

O15162

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PLSCR1 Rabbit Polyclonal Antibody (orb583593) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_066928

Preservative

Lyophilized powder

AA Sequence

MDKQNSQMNASHPETNLPVGYPPQYPPTAFQGPPGYSGYPGPQVSYPPPP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MFluor™ Blue 660 Styramide
45074-AAT 100 Slides

MFluor™ Blue 660 Styramide

Sign In for Pricing
View Details
Tissue Total RNA, Colon: right
CR560613 5 µg

Tissue Total RNA, Colon: right

Sign In for Pricing
View Details
Ɑ-Methoxy-ω-Formylpentanamido PEG
125000-6.5G 5 g

Ɑ-Methoxy-ω-Formylpentanamido PEG

Sign In for Pricing
View Details
eIF3g Recombinant Rabbit Monoclonal Antibody [PSH09-42]
HA723104 100 µL

eIF3g Recombinant Rabbit Monoclonal Antibody [PSH09-42]

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS500195 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
Biotin Coated - 96 well plates - 8 Well Breakable Strips on single well holding frame - White PS
MGW15F-BIO 10x 96 Well Plates

Biotin Coated - 96 well plates - 8 Well Breakable Strips on single well holding frame - White PS

Sign In for Pricing
View Details