Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

POFUT1 Peptide - middle region

POFUT1 Peptide - middle region

Product Specifications

Product Name Alternative

FUT12, KIAA0180, MGC2482, O-FUT, O-Fuc-T, O-FucT-1

UniProt

Q6EV69

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with POFUT1 Rabbit Polyclonal Antibody (orb584334) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_056167

Preservative

Lyophilized powder

AA Sequence

RVISLEDFMEKLAPTHWPPEKRVAYCFEVAAQRSPDKKTCPMKEGNPFGP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CB1 antagonist 5
HY-120653-01 5 mg

CB1 antagonist 5

Sign In for Pricing
View Details
CB1 antagonist 5
HY-120653-02 10 mg

CB1 antagonist 5

Sign In for Pricing
View Details
CB1 antagonist 5
HY-120653-03 25 mg

CB1 antagonist 5

Sign In for Pricing
View Details
CB1 antagonist 5
HY-120653-04 50 mg

CB1 antagonist 5

Sign In for Pricing
View Details
Hi-PCR® Bacillus subtilis Semi-Q PCR Kit
MBPCR053-10R 1 unit

Hi-PCR® Bacillus subtilis Semi-Q PCR Kit

Sign In for Pricing
View Details
HH-F-PK AB Labels
026105 Pack of 900 Label(s)

HH-F-PK AB Labels

Sign In for Pricing
View Details