Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pou4f3 Peptide - N-terminal region

Pou4f3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Brn3.1, Brn3c, ddl, dreidel

UniProt

Q63955

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Pou4f3 Rabbit Polyclonal Antibody (orb329703) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_620395

Preservative

Lyophilized powder

AA Sequence

PKFSSLHSGSEAMRRVCLPAPQLQGNIFGSFDESLLARAEALAAVDIVSH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lcn6 Rat shRNA Plasmid (Locus ID 414138)
TR700421 1 Kit

Lcn6 Rat shRNA Plasmid (Locus ID 414138)

Sign In for Pricing
View Details
CHUK Antibody
OAPB00062-100UG 0.1 mg

CHUK Antibody

Sign In for Pricing
View Details
Wnt10b Peptide
4619P 0.05 mg

Wnt10b Peptide

Sign In for Pricing
View Details
Risuteganib hydrochloride
orb1984037-01 100 mg

Risuteganib hydrochloride

Sign In for Pricing
View Details
Risuteganib hydrochloride
orb1984037-02 500 mg

Risuteganib hydrochloride

Sign In for Pricing
View Details
Hirudin (desulfated) Peptide
abx266688-01 1 mg

Hirudin (desulfated) Peptide

Sign In for Pricing
View Details