Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pou4f3 Peptide - N-terminal region

Pou4f3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Brn3.1, Brn3c, ddl, dreidel

UniProt

Q63955

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Pou4f3 Rabbit Polyclonal Antibody (orb329703) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_620395

Preservative

Lyophilized powder

AA Sequence

PKFSSLHSGSEAMRRVCLPAPQLQGNIFGSFDESLLARAEALAAVDIVSH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sheep Calprotectin (CALP) ELISA Kit
YLA0154SH-01 48 Tests

Sheep Calprotectin (CALP) ELISA Kit

Sign In for Pricing
View Details
Sheep Calprotectin (CALP) ELISA Kit
YLA0154SH-02 96 Tests

Sheep Calprotectin (CALP) ELISA Kit

Sign In for Pricing
View Details
SRSF3 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
45518066 1.0 µg DNA

SRSF3 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
PFKFB3 siRNA (Rat)
CRR3099-01 15 nmol

PFKFB3 siRNA (Rat)

Sign In for Pricing
View Details
PFKFB3 siRNA (Rat)
CRR3099-02 30 nmol

PFKFB3 siRNA (Rat)

Sign In for Pricing
View Details
Human Monoclonal CD47 Antibody (ligufalimab) [PE]
NBP3-27992PE 0.1 mL

Human Monoclonal CD47 Antibody (ligufalimab) [PE]

Sign In for Pricing
View Details