Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pou4f3 Peptide - N-terminal region

Pou4f3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Brn3.1, Brn3c, ddl, dreidel

UniProt

Q63955

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Pou4f3 Rabbit Polyclonal Antibody (orb329703) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_620395

Preservative

Lyophilized powder

AA Sequence

PKFSSLHSGSEAMRRVCLPAPQLQGNIFGSFDESLLARAEALAAVDIVSH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFNAG Antibody
CSB-PA344226LA01BO-01 50 µg

IFNAG Antibody

Sign In for Pricing
View Details
IFNAG Antibody
CSB-PA344226LA01BO-02 100 µg

IFNAG Antibody

Sign In for Pricing
View Details
Etfbkmt Mouse Gene Knockout Kit (CRISPR)
KN509999 1 Kit

Etfbkmt Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
C8orf74 sgRNA CRISPR Lentivector set (Human)
K0262801 3x 1.0 µg

C8orf74 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
ALPI Protein Vector (Rat) (pPM-C-His)
PV253337 500 ng

ALPI Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
TGF β Receptor II Polyclonal Antibody
E-AB-33088-01 20 µL

TGF β Receptor II Polyclonal Antibody

Sign In for Pricing
View Details