Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRPSAP2 Peptide - middle region

PRPSAP2 Peptide - middle region

Product Specifications

Product Name Alternative

MGC117304, MGC126719, MGC126721, PAP41

UniProt

O60256

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PRPSAP2 Rabbit Polyclonal Antibody (orb583164) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002758

Preservative

Lyophilized powder

AA Sequence

DYRNKSPASAKRAQSFAERLRLGIAVIHGEAQDAESDLVDGRHSP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FCRL2 Polyclonal Antibody
JOT-AP15573-01 20 µL

FCRL2 Polyclonal Antibody

Sign In for Pricing
View Details
FCRL2 Polyclonal Antibody
JOT-AP15573-02 50 μL

FCRL2 Polyclonal Antibody

Sign In for Pricing
View Details
FCRL2 Polyclonal Antibody
JOT-AP15573-03 100 µL

FCRL2 Polyclonal Antibody

Sign In for Pricing
View Details
1-Hexyl-2,3-dimethylimidazolium iodide
IL-0138-HP-0025 25 g

1-Hexyl-2,3-dimethylimidazolium iodide

Sign In for Pricing
View Details
Human apolipoprotein A5, Apo-A5 ELISA Kit
MBS703672-01 24 Well (LIMIT 1)

Human apolipoprotein A5, Apo-A5 ELISA Kit

Sign In for Pricing
View Details
Human apolipoprotein A5, Apo-A5 ELISA Kit
MBS703672-02 48 Well

Human apolipoprotein A5, Apo-A5 ELISA Kit

Sign In for Pricing
View Details