Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRSS1 Peptide - N-terminal region

PRSS1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC120175, MGC149362, TRP1, TRY1, TRY4, TRYP1

UniProt

P07477

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PRSS1 Rabbit Polyclonal Antibody (orb584857) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002760

Preservative

Lyophilized powder

AA Sequence

LILTFVAAALAAPFDDDDKIVGGYNCEENSVPYQVSLNSGYHFCGGSLIN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Annexin V-EGFP Azide-Free Lyophilized Powder
E-CK-A119U-01 25 µg

Annexin V-EGFP Azide-Free Lyophilized Powder

Sign In for Pricing
View Details
Annexin V-EGFP Azide-Free Lyophilized Powder
E-CK-A119U-02 100 µg

Annexin V-EGFP Azide-Free Lyophilized Powder

Sign In for Pricing
View Details
DLX4 (NM_001934) Human Over-expression Lysate
LY419636 100 µg

DLX4 (NM_001934) Human Over-expression Lysate

Sign In for Pricing
View Details
PPP2R5D Rabbit Polyclonal Antibody
TA380266 100 µL

PPP2R5D Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
BAX Monoclonal Antibody
E-AB-22128-01 20 µL

BAX Monoclonal Antibody

Sign In for Pricing
View Details
BAX Monoclonal Antibody
E-AB-22128-02 60 µL

BAX Monoclonal Antibody

Sign In for Pricing
View Details