Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

QARS Peptide - N-terminal region

QARS Peptide - N-terminal region

Product Specifications

Product Name Alternative

GLNRS, PRO2195

UniProt

P47897

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with QARS Rabbit Polyclonal Antibody (orb583240) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005042

Preservative

Lyophilized powder

AA Sequence

DQTLSLMEQLRGEALKFHKPGENYKTPGYVVTPHTMNLLKQHLEITGGQV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-(1-(2-Ethoxyethyl)piperidin-4-yl)-1H-benzo[d]imidazole
TRC-E125800-250MG 250 mg

2-(1-(2-Ethoxyethyl)piperidin-4-yl)-1H-benzo[d]imidazole

Sign In for Pricing
View Details
HSP27 (Heat Shock Protein 27) (rHSPB1/774), CF488A conjugate, 0.1mg/mL
BNC882308-500 1x 500 µL

HSP27 (Heat Shock Protein 27) (rHSPB1/774), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
One-step TUNEL In Situ Apoptosis Kit (Red, Elab Fluor® 647)
E-CK-A324-01 20 Assays

One-step TUNEL In Situ Apoptosis Kit (Red, Elab Fluor® 647)

Sign In for Pricing
View Details
One-step TUNEL In Situ Apoptosis Kit (Red, Elab Fluor® 647)
E-CK-A324-02 50 Assays

One-step TUNEL In Situ Apoptosis Kit (Red, Elab Fluor® 647)

Sign In for Pricing
View Details
One-step TUNEL In Situ Apoptosis Kit (Red, Elab Fluor® 647)
E-CK-A324-03 100 Assays

One-step TUNEL In Situ Apoptosis Kit (Red, Elab Fluor® 647)

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS622630 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details