Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAC1 Peptide - middle region

RAC1 Peptide - middle region

Product Specifications

Product Name Alternative

MGC111543, MIG5, TC-25, p21-Rac1, Rac-1

UniProt

P60763

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RAC1 Rabbit Polyclonal Antibody (orb330944) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_008839

Preservative

Lyophilized powder

AA Sequence

LAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DR5 (TNFRSF10B) (NM_003842) Human Over-expression Lysate
LY401260 100 µg

DR5 (TNFRSF10B) (NM_003842) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Human E2F2 protein (His tag)
PDEH101062-01 20 µg

Recombinant Human E2F2 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human E2F2 protein (His tag)
PDEH101062-02 100 µg

Recombinant Human E2F2 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human E2F2 protein (His tag)
PDEH101062-03 500 µg

Recombinant Human E2F2 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human E2F2 protein (His tag)
PDEH101062-04 1 mg

Recombinant Human E2F2 protein (His tag)

Sign In for Pricing
View Details
RABL2B Human Gene Knockout Kit (CRISPR)
KN413570 1 Kit

RABL2B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details