Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RALA Peptide - middle region

RALA Peptide - middle region

Product Specifications

Product Name Alternative

MGC48949, RAL

UniProt

P11233

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RALA Rabbit Polyclonal Antibody (orb330875) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005393

Preservative

Lyophilized powder

AA Sequence

GQEDYAAIRDNYFRSGEGFLCVFSITEMESFAATADFREQILRVKEDENV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Shewanella denitrificans Cobalamin synthase (cobS)
orb2911412-01 20 µg

Recombinant Shewanella denitrificans Cobalamin synthase (cobS)

Sign In for Pricing
View Details
Recombinant Shewanella denitrificans Cobalamin synthase (cobS)
orb2911412-02 100 µg

Recombinant Shewanella denitrificans Cobalamin synthase (cobS)

Sign In for Pricing
View Details
Anti-Human ZBTB18 Polyclonal Antibody
HP671014-01 50 µg

Anti-Human ZBTB18 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Human ZBTB18 Polyclonal Antibody
HP671014-02 100 µg

Anti-Human ZBTB18 Polyclonal Antibody

Sign In for Pricing
View Details
MSH6 Antibody
MBS9608169-01 0.1 mL

MSH6 Antibody

Sign In for Pricing
View Details
MSH6 Antibody
MBS9608169-02 0.2 mL

MSH6 Antibody

Sign In for Pricing
View Details