Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shewanella denitrificans Cobalamin synthase (cobS)

This Recombinant Shewanella denitrificans Cobalamin synthase (cobS) spans the amino acid sequence from region 1-262.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

Q12Q70

Expression Region

1-262

Origin

Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSNEYNWLRQLNLFFVATGFFTRLPTPSWVIADDNELKKSSRYFGLVGLLIGLICALVYW FTQQWLPTSVAVLLAMVAGVLVTGGFHEDGLADTADGFLGGKTFEDKLRIMKDNHLGSYG AIVLALILLLRWQLLVELALFSPWAAITGFIVAHTLSRVLAASLIFSVKYVTDLELEEGK RLSHDQSLNDLFILLASGIFVLFWLNGLAAFVLFISLWALRFCLCKYFRSQIGGYTGDTL DAAQQVSEIMCYLIILAVGLSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CPNE4 (NM_130808) Human Over-expression Lysate
LC403330 20 µg

CPNE4 (NM_130808) Human Over-expression Lysate

Sign In for Pricing
View Details
Ɑ-Methoxy-ω-Succinamic Acid NHS Ester PEG
12750-35.5G 5 g

Ɑ-Methoxy-ω-Succinamic Acid NHS Ester PEG

Sign In for Pricing
View Details
Biological Safety Cabinet Class II BCBS-801
BCBS-801 1 Unit

Biological Safety Cabinet Class II BCBS-801

Sign In for Pricing
View Details
Ultrasonic Homogenizer BLIH-303
BLIH-303 1 Unit

Ultrasonic Homogenizer BLIH-303

Sign In for Pricing
View Details
GRSF1 (NM_002092) Human Over-expression Lysate
LC419541 20 µg

GRSF1 (NM_002092) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Blocks, Adipose tissue
CB504972 1 Block

Frozen Tissue Blocks, Adipose tissue

Sign In for Pricing
View Details