Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rest Peptide - middle region

Rest Peptide - middle region

Product Specifications

Product Name Alternative

2610008J04Rik, AA407358, MGC150099, NRSF

UniProt

Q8VIG1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Rest Rabbit Polyclonal Antibody (orb576774) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_035393

Preservative

Lyophilized powder

AA Sequence

ANMGMALTNDMYDLHELSKAELAAPQLIMLANVALTGEASGSCCDYLVGE

More Discoveries

Explore Other Products

Browse additional items from our catalog

GlµL Mouse shRNA Plasmid (Locus ID 14645)
TL513862 1 Kit

GlµL Mouse shRNA Plasmid (Locus ID 14645)

Sign In for Pricing
View Details
DNM1P26 ORF Vector (Human) (pORF)
18447011 1.0 µg DNA

DNM1P26 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
CENPN Peptide - middle region
orb2011261 100 µg

CENPN Peptide - middle region

Sign In for Pricing
View Details
Brinp3 (NM_173121) Rat Tagged ORF Clone Lentiviral Particle
RR213907L4V 200 µL

Brinp3 (NM_173121) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Chd6 (NM_001107797) Rat Tagged ORF Clone
RR211560 10 µg

Chd6 (NM_001107797) Rat Tagged ORF Clone

Sign In for Pricing
View Details
Mouse Paired immunoglobulin-like type 2 receptor beta-2 (PILRB2) ELISA Kit
abx538914 96 Tests

Mouse Paired immunoglobulin-like type 2 receptor beta-2 (PILRB2) ELISA Kit

Sign In for Pricing
View Details