CENPN Peptide - middle region
CENPN Peptide - middle region
Product Specifications
Product Name Alternative
BM039, C16orf60, CENP-N, FLJ13607, FLJ22660
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CENPN Rabbit Polyclonal Antibody (orb583496) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
IF, WB
NCBI Accession Number
NP_001094095
Preservative
Lyophilized powder
AA Sequence
SFKKILQRALKNVTVSFRETEENAVWIRIAWGTQYTKPNQYKPTYVVYYS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
K3317102 1.0 µg DNA
Amtn sgRNA CRISPR Lentivector (Mouse) (Target 1)
Sign In for Pricing
View Details 
MBS6302872-01 0.1 mL
GNA13, ID (GNA13, Guanine nucleotide-binding protein subunit alpha-13) (MaxLight 650)
Sign In for Pricing
View Details MBS6302872-02 5x 0.1 mL
GNA13, ID (GNA13, Guanine nucleotide-binding protein subunit alpha-13) (MaxLight 650)
Sign In for Pricing
View Details 036185-ML550 100 µL
GP9, CT (GP9, Platelet glycoprotein IX, Glycoprotein 9, CD42a) (MaxLight 550)
Sign In for Pricing
View Details abx658796-01 10 µg
Mouse Long-Chain Specific Acyl-Coa Dehydrogenase, Mitochondrial (ACADL) Protein
Sign In for Pricing
View Details