Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rod1 Peptide - N-terminal region

Rod1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

5830471K22Rik, AA407443, AI462022, AW107884, C86549, MGC11742, Rod1

UniProt

Q8BHD7

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Rod1 Rabbit Polyclonal Antibody (orb577671) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_659153

Preservative

Lyophilized powder

AA Sequence

YYTPVTPHLRSQPVYIQYSNHRELKTDNLPNQARAQAALQAVSAVQSGNL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HBG1/HBG2 Polyclonal Antibody
E-AB-52690-01 20 µL

HBG1/HBG2 Polyclonal Antibody

Sign In for Pricing
View Details
HBG1/HBG2 Polyclonal Antibody
E-AB-52690-02 60 µL

HBG1/HBG2 Polyclonal Antibody

Sign In for Pricing
View Details
HBG1/HBG2 Polyclonal Antibody
E-AB-52690-03 120 µL

HBG1/HBG2 Polyclonal Antibody

Sign In for Pricing
View Details
HBG1/HBG2 Polyclonal Antibody
E-AB-52690-04 200 µL

HBG1/HBG2 Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Myeloid tissue
CS627744 5x 5 µm

Frozen Tissue Sections, Myeloid tissue

Sign In for Pricing
View Details
PTIP (PAXIP1) Human Gene Knockout Kit (CRISPR)
KN415446 1 Kit

PTIP (PAXIP1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details