Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPL22 Peptide - C-terminal region

RPL22 Peptide - C-terminal region

Product Specifications

Product Name Alternative

EAP, HBP15, HBP15/L22, L22

UniProt

P35268

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RPL22 Rabbit Polyclonal Antibody (orb331236) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000974

Preservative

Lyophilized powder

AA Sequence

TSEVPFSKRYLKYLTKKYLKKNNLRDWLRVVANSKESYELRYFQINQDEE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Midostaurin
SIH-468-5MG 5 mg

Midostaurin

Sign In for Pricing
View Details
ICOS Ligand (ICOSLG) (NM_015259) Human Over-expression Lysate
LC402420 20 µg

ICOS Ligand (ICOSLG) (NM_015259) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Nicastrin Antibody
RC-6996-01 50 μL

Recombinant Nicastrin Antibody

Sign In for Pricing
View Details
Recombinant Nicastrin Antibody
RC-6996-02 100 µL

Recombinant Nicastrin Antibody

Sign In for Pricing
View Details
Recombinant Nicastrin Antibody
RC-6996-03 1 mL

Recombinant Nicastrin Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS707388 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details