Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPS13 Peptide - middle region

RPS13 Peptide - middle region

Product Specifications

Product Name Alternative

S13

UniProt

P62277

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RPS13 Rabbit Polyclonal Antibody (orb583046) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001008

Preservative

Lyophilized powder

AA Sequence

ILRILKSKGLAPDLPEDLYHLIKKAVAVRKHLERNRKDKDAKFRLILIES

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NFKBIA antibody
FNab04196 100 µg

NFKBIA antibody

Sign In for Pricing
View Details
DNAJC22 Protein Vector (Mouse) (pPM-C-HA)
PV172772 500 ng

DNAJC22 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Mouse Gm13057 (NM_001113735) AAV Particle
MR212567A1V 250 µL

Mouse Gm13057 (NM_001113735) AAV Particle

Sign In for Pricing
View Details
Rdh14 (NM_001109276) Rat Tagged ORF Clone
RR208951 10 µg

Rdh14 (NM_001109276) Rat Tagged ORF Clone

Sign In for Pricing
View Details
Twist Family BHLH Transcription Factor 2 (TWIST2) Antibody
abx321106-01 20 µL

Twist Family BHLH Transcription Factor 2 (TWIST2) Antibody

Sign In for Pricing
View Details
Twist Family BHLH Transcription Factor 2 (TWIST2) Antibody
abx321106-02 50 µL

Twist Family BHLH Transcription Factor 2 (TWIST2) Antibody

Sign In for Pricing
View Details