Rpsa Peptide - N-terminal region
Rpsa Peptide - N-terminal region
Product Specifications
Product Name Alternative
67kDa, 67lr, AL022858, Lamr, Lamr1, Lamrl1, MGC117921, MGC118614, MLR, P40, P40-3, P40-8
UniProt
P14206
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Rpsa Rabbit Polyclonal Antibody (orb330769) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_035159
Preservative
Lyophilized powder
AA Sequence
QMKEEDVLKFLAAGTHLGGTNLDFQMEQYIYKRKSDGIYIINLKRTWEKL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Dkk3 Recombinant Rabbit Monoclonal Antibody [JE35-98]](https://cdn.genprice.uk/products/992/68dd1c8d061270361ea81e99/imageurl/ha722396.webp)
HA722396 100 µL
Dkk3 Recombinant Rabbit Monoclonal Antibody [JE35-98]
Sign In for Pricing
View Details ![Myotilin (MYOT) Mouse Monoclonal Antibody [Clone ID: OTI8A7]](https://cdn.genprice.uk/products/937/68dd18ba061270361e908630/imageurl/cf809549.webp)
CF809549 100 µg
Myotilin (MYOT) Mouse Monoclonal Antibody [Clone ID: OTI8A7]
Sign In for Pricing
View Details ![FITC Anti-Mouse CD172a/SIRPα Antibody[P84]](https://cdn.genprice.uk/products/763/68dd14a2061270361e7d0ed1/imageurl/e-ab-f1286c.webp)
E-AB-F1286C-02 100 Tests
FITC Anti-Mouse CD172a/SIRPα Antibody[P84]
Sign In for Pricing
View Details