Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SEPT-12 Peptide - middle region

SEPT-12 Peptide - middle region

Product Specifications

Product Name Alternative

1700028G04Rik, 4933413B09Rik, MGC144518, Septin12

UniProt

Q9D451

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SEPT12 Rabbit Polyclonal Antibody (orb55691) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_081945

Preservative

Lyophilized powder

AA Sequence

KGLKLKLTVTDTPGFGDQINNDKCWDPILSYINQQYEQYLQEELLITRQR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cell Navigator® Fluorimetric Lipid Droplet Assay Kit *Green Fluorescence*
22730-AAT 200 Tests

Cell Navigator® Fluorimetric Lipid Droplet Assay Kit *Green Fluorescence*

Sign In for Pricing
View Details
Nucleophosmin (Acute Myeloid Leukemia Marker) (rNPM1/1901), CF640R conjugate, 0.1mg/mL
BNC403807-500 1x 500 µL

Nucleophosmin (Acute Myeloid Leukemia Marker) (rNPM1/1901), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Catenin, gamma (Cardiomyocyte Marker) (CTNG/2155R), CF640R conjugate, 0.1mg/mL
BNC402155-100 1x 100 µL

Catenin, gamma (Cardiomyocyte Marker) (CTNG/2155R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Aphidicolin
SIH-605-5MG 5 mg

Aphidicolin

Sign In for Pricing
View Details
L-Homocysteine Thiolactone Hydrochloride
TRC-H591960-250MG 250 mg

L-Homocysteine Thiolactone Hydrochloride

Sign In for Pricing
View Details
DSG4 Polyclonal Antibody
E-AB-90192-01 60 µL

DSG4 Polyclonal Antibody

Sign In for Pricing
View Details