Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC30A3 Peptide - middle region

SLC30A3 Peptide - middle region

Product Specifications

Product Name Alternative

ZNT3

UniProt

Q99726

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLC30A3 Rabbit Polyclonal Antibody (orb578961) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003450

Preservative

Lyophilized powder

AA Sequence

AMLLTASIAVCANLLMAFVLHQAGPPHSHGSRGAEYAPLEEGPEEPLPLG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Butanoic Acid
TRC-B692235-500G 500 g

Butanoic Acid

Sign In for Pricing
View Details
Rnf148 Mouse Gene Knockout Kit (CRISPR)
KN514912 1 Kit

Rnf148 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
DOK4 Human Gene Knockout Kit (CRISPR)
KN402561 1 Kit

DOK4 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
IL13 receptor alpha 2 (IL13RA2) (NM_000640) Human Over-expression Lysate
LY424589 100 µg

IL13 receptor alpha 2 (IL13RA2) (NM_000640) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Human PPARGC1B protein (His tag)
PDEH101008-01 20 µg

Recombinant Human PPARGC1B protein (His tag)

Sign In for Pricing
View Details
Recombinant Human PPARGC1B protein (His tag)
PDEH101008-02 100 µg

Recombinant Human PPARGC1B protein (His tag)

Sign In for Pricing
View Details