Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SRL Peptide - C-terminal region

SRL Peptide - C-terminal region

Product Specifications

UniProt

Q86TD4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SRL Rabbit Polyclonal Antibody (orb326459) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001092284

Preservative

Lyophilized powder

AA Sequence

QMLMRVYGALFWSLAPLINVTEPPRVYVSSFWPQEYKPDTHQELFLQEEI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BIBW 2992
SIH-496-25MG 25 mg

BIBW 2992

Sign In for Pricing
View Details
Cabyr Mouse Gene Knockout Kit (CRISPR)
KN502410 1 Kit

Cabyr Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS701442 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Tissue Total RNA, Colon
CR561807 5 µg

Tissue Total RNA, Colon

Sign In for Pricing
View Details
AIF1 / Iba1 (Microglia Marker) (AIF1/2493), CF405S conjugate, 0.1mg/mL
BNC042493-100 1x 100 µL

AIF1 / Iba1 (Microglia Marker) (AIF1/2493), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Sodium Nafcillin Monohydrate
TRC-S645800-5G 5 g

Sodium Nafcillin Monohydrate

Sign In for Pricing
View Details