Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Stat5b Peptide - C-terminal region

Stat5b Peptide - C-terminal region

Product Specifications

UniProt

P42232

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Stat5b Rabbit Polyclonal Antibody (orb576221) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

NCBI Accession Number

NP_035619

Preservative

Lyophilized powder

AA Sequence

PVVCPQAHYNMYPPNPDSVLDTDGDFDLEDTMDVARRVEELLGRPMDSQW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DGKG (NM_001080745) Human Over-expression Lysate
LC421107 20 µg

DGKG (NM_001080745) Human Over-expression Lysate

Sign In for Pricing
View Details
6 x 50ml horizontal rotisserie, 1 ea
R4040-HZ50 1 Each

6 x 50ml horizontal rotisserie, 1 ea

Sign In for Pricing
View Details
ATF3 (NM_001674) Human Over-expression Lysate
LY419814 100 µg

ATF3 (NM_001674) Human Over-expression Lysate

Sign In for Pricing
View Details
Santacruzamate A
SIH-613-25MG 25 mg

Santacruzamate A

Sign In for Pricing
View Details
Alpha-Tocopherol Acetate
TRC-T526115-25G 25 g

Alpha-Tocopherol Acetate

Sign In for Pricing
View Details
Appbp2 Mouse Gene Knockout Kit (CRISPR)
KN501443 1 Kit

Appbp2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details