Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TAPBP Peptide - N-terminal region

TAPBP Peptide - N-terminal region

Product Specifications

Product Name Alternative

NGS17, TAPA, TPN, TPSN

UniProt

O15533

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TAPBP Rabbit Polyclonal Antibody (orb579462) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_757345

Preservative

Lyophilized powder

AA Sequence

GKGLAKRPGALLLRQGPGEPPPRPDLDPELYLSVHDPAGALQAAFRRYPR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Anti-Mouse PD-L1 (10F.9G2) Recombinant Antibody
ICH1183-25mg 25 mg

Mouse Anti-Mouse PD-L1 (10F.9G2) Recombinant Antibody

Sign In for Pricing
View Details
TCP11X2 (NM_001277423) Human Tagged ORF Clone
RG238023 10 µg

TCP11X2 (NM_001277423) Human Tagged ORF Clone

Sign In for Pricing
View Details
Hexamidine Impurity A Hydrochloride
TRC-H294350-10MG 10 mg

Hexamidine Impurity A Hydrochloride

Sign In for Pricing
View Details
Human SI activation kit by CRISPRa
GA104407 1 Kit

Human SI activation kit by CRISPRa

Sign In for Pricing
View Details
EGFR (GFR450), CF740 conjugate, 0.1mg/mL
BNC740450-100 1x 100 µL

EGFR (GFR450), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS701222 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details