Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

THEG Peptide - middle region

THEG Peptide - middle region

Product Specifications

Product Name Alternative

CT56, MGC26138, THEG1

UniProt

Q9P2T0

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with THEG Rabbit Polyclonal Antibody (orb326236) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_954672

Preservative

Lyophilized powder

AA Sequence

LKDRPSVYWTERFLEDTTLTITVPAVSRRVEELSRPKRFYLEYYNNNRTT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM25 Antibody
KC-3201-01 50 μL

TMEM25 Antibody

Sign In for Pricing
View Details
TMEM25 Antibody
KC-3201-02 100 µL

TMEM25 Antibody

Sign In for Pricing
View Details
TMEM25 Antibody
KC-3201-03 1 mL

TMEM25 Antibody

Sign In for Pricing
View Details
Txnrd3 Mouse Gene Knockout Kit (CRISPR)
KN518523 1 Kit

Txnrd3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TIE2 (TEK) (NM_000459) Human Over-expression Lysate
LC424703 20 µg

TIE2 (TEK) (NM_000459) Human Over-expression Lysate

Sign In for Pricing
View Details
CrkL Rabbit Polyclonal Antibody
HA500536 100 µL

CrkL Rabbit Polyclonal Antibody

Sign In for Pricing
View Details