Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Thrb Peptide - N-terminal region

Thrb Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC141269, MGC141270, Nr1a2, T3R[b], T3Rbeta, Thrb1, Thrb2, c-erbAbeta

UniProt

P37242

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Thrb Rabbit Polyclonal Antibody (orb329902) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

ChIP, WB

NCBI Accession Number

NP_033406

Preservative

Lyophilized powder

AA Sequence

MNYCMPEVHEVCPAASSNCYMQVTDYLAYLEDSPALSGRDVQAVPSSSIY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ethylene Terephthalate Cyclic Heptamer
TRC-E918175-2.5MG 2.5 mg

Ethylene Terephthalate Cyclic Heptamer

Sign In for Pricing
View Details
CD74 Polyclonal Antibody
AN006060L-01 25 µL

CD74 Polyclonal Antibody

Sign In for Pricing
View Details
CD74 Polyclonal Antibody
AN006060L-02 100 µL

CD74 Polyclonal Antibody

Sign In for Pricing
View Details
CD20 Human Recombinant Protein, Membrane Nanoparticle
TP721398M 100 µg

CD20 Human Recombinant Protein, Membrane Nanoparticle

Sign In for Pricing
View Details
WDR37 (C-term) Rabbit Polyclonal Antibody
AP54541PU-N 400 µL

WDR37 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Ovary
CS700181 5x 5 µm

Tissue FFPE Sections, Ovary

Sign In for Pricing
View Details