Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CEMIP2 Peptide - N-terminal region

CEMIP2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Tmem2

UniProt

Q5FWI3

Field of Research

Cardiovascular Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CEMIP2 Rabbit Polyclonal Antibody (orb325001) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001028931

Preservative

Lyophilized powder

AA Sequence

MYAAGSRGHSPAFLQPQNGNGHRSPGYVPGKVVPLRPAPPPKNHASAKLT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DRD5 Polyclonal Antibody
E-AB-92517-01 60 µL

DRD5 Polyclonal Antibody

Sign In for Pricing
View Details
DRD5 Polyclonal Antibody
E-AB-92517-02 120 µL

DRD5 Polyclonal Antibody

Sign In for Pricing
View Details
DRD5 Polyclonal Antibody
E-AB-92517-03 200 µL

DRD5 Polyclonal Antibody

Sign In for Pricing
View Details
Magic™ Membrane Protein Human SIGLEC6 (Sialic acid binding Ig like lectin 6) Expressed in vitro E.coli expression system, Full Length of Mature Protein
MPX3899K Each

Magic™ Membrane Protein Human SIGLEC6 (Sialic acid binding Ig like lectin 6) Expressed in vitro E.coli expression system, Full Length of Mature Protein

Sign In for Pricing
View Details
Recombinant human G3BP1 protein
ATGP0841-050 50 µg

Recombinant human G3BP1 protein

Sign In for Pricing
View Details
Complement Component 1, S Subcomponent (C1s) BioAssayTM ELISA Kit (Human)
024339-01 48 Tests

Complement Component 1, S Subcomponent (C1s) BioAssayTM ELISA Kit (Human)

Sign In for Pricing
View Details