Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tmem33 Peptide - middle region

Tmem33 Peptide - middle region

Product Specifications

Product Name Alternative

Tmem33

UniProt

Q9Z142

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Tmem33 Rabbit Polyclonal Antibody (orb580043) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001029370

Preservative

Lyophilized powder

AA Sequence

LLHAATYTKKVLDAKGSNSLPLLRSVLDKLSTNQQNILKFIACNEIFLMP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-PFKFB3/PFK2 (Ser467) Polyclonal Antibody, AbBy Fluor™ 405 Conjugated
bs-3331R-BF405-TR 20 µL

Phospho-PFKFB3/PFK2 (Ser467) Polyclonal Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
Mouse G-CSF Rabbit mAb
MBS9148053-01 0.02 mL

Mouse G-CSF Rabbit mAb

Sign In for Pricing
View Details
Mouse G-CSF Rabbit mAb
MBS9148053-02 0.1 mL

Mouse G-CSF Rabbit mAb

Sign In for Pricing
View Details
Mouse G-CSF Rabbit mAb
MBS9148053-03 5x 0.1 mL

Mouse G-CSF Rabbit mAb

Sign In for Pricing
View Details
N-Octyl-beta-D-thioglucopyranoside (ultrapure)
bs-75004C-01 1 g

N-Octyl-beta-D-thioglucopyranoside (ultrapure)

Sign In for Pricing
View Details
N-Octyl-beta-D-thioglucopyranoside (ultrapure)
bs-75004C-02 5 g

N-Octyl-beta-D-thioglucopyranoside (ultrapure)

Sign In for Pricing
View Details