Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMPRSS3 Peptide - N-terminal region

TMPRSS3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DFNB10, DFNB8, ECHOS1, TADG12

UniProt

Q8WY52

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TMPRSS3 Rabbit Polyclonal Antibody (orb330937) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_115781

Preservative

Lyophilized powder

AA Sequence

MGENDPPAVEAPFSFRSLFGLDDLKISPVAPDADAVAAQILSLLPLKFFP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dcaf17 Mouse shRNA Plasmid (Locus ID 75763)
TL505097 1 Kit

Dcaf17 Mouse shRNA Plasmid (Locus ID 75763)

Sign In for Pricing
View Details
ARHGAP25 Rabbit pAb (APR20237N)
APR20237N-01 50 µL

ARHGAP25 Rabbit pAb (APR20237N)

Sign In for Pricing
View Details
ARHGAP25 Rabbit pAb (APR20237N)
APR20237N-02 100 µL

ARHGAP25 Rabbit pAb (APR20237N)

Sign In for Pricing
View Details
ARHGAP25 Rabbit pAb (APR20237N)
APR20237N-03 200 µL

ARHGAP25 Rabbit pAb (APR20237N)

Sign In for Pricing
View Details
Recombinant Macaca fascicularis Lymphotoxin beta receptor (LTBR), partial (Active)
orb2986911-01 20 µg

Recombinant Macaca fascicularis Lymphotoxin beta receptor (LTBR), partial (Active)

Sign In for Pricing
View Details
Recombinant Macaca fascicularis Lymphotoxin beta receptor (LTBR), partial (Active)
orb2986911-02 100 µg

Recombinant Macaca fascicularis Lymphotoxin beta receptor (LTBR), partial (Active)

Sign In for Pricing
View Details