Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TOM1 Peptide - middle region

TOM1 Peptide - middle region

Product Specifications

Product Name Alternative

FLJ33404

UniProt

O60784

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TOM1 Rabbit Polyclonal Antibody (orb581560) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005479

Preservative

Lyophilized powder

AA Sequence

SGRLEDEFDMFALTRGSSLADQRKEVKYEAPQATDGLAGALDARQQSTGA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glucocorticoid Receptor (NR3C1) Human Gene Knockout Kit (CRISPR)
KN204878LP 1 Kit

Glucocorticoid Receptor (NR3C1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Aspartate Aminotransferase (AST/GOT) Activity Assay Kit
E-BC-K236-M-01 48 T (19 samples)

Aspartate Aminotransferase (AST/GOT) Activity Assay Kit

Sign In for Pricing
View Details
Aspartate Aminotransferase (AST/GOT) Activity Assay Kit
E-BC-K236-M-02 96 T (43 samples)

Aspartate Aminotransferase (AST/GOT) Activity Assay Kit

Sign In for Pricing
View Details
KIRREL3 Antibody (Biotin)
KB-3214-01 50 μL

KIRREL3 Antibody (Biotin)

Sign In for Pricing
View Details
KIRREL3 Antibody (Biotin)
KB-3214-02 100 µL

KIRREL3 Antibody (Biotin)

Sign In for Pricing
View Details
KIRREL3 Antibody (Biotin)
KB-3214-03 1 mL

KIRREL3 Antibody (Biotin)

Sign In for Pricing
View Details