Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRIM25 Peptide - middle region

TRIM25 Peptide - middle region

Product Specifications

Product Name Alternative

EFP, RNF147, Z147, ZNF147

UniProt

Q14258

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TRIM25 Rabbit Polyclonal Antibody (orb583871) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005073

Preservative

Lyophilized powder

AA Sequence

LLDASETTSTRKIKEEEKRVNSKFDTIYQILLKKKSEIQTLKEEIEQSLT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal Antibody against MAP2K4 (Clone EP615Y)
TA300580 100 µL

Rabbit Monoclonal Antibody against MAP2K4 (Clone EP615Y)

Sign In for Pricing
View Details
Cerdulatinib hydrochloride
T6104-01 2 mg

Cerdulatinib hydrochloride

Sign In for Pricing
View Details
Cerdulatinib hydrochloride
T6104-02 5 mg

Cerdulatinib hydrochloride

Sign In for Pricing
View Details
Cerdulatinib hydrochloride
T6104-03 10 mg

Cerdulatinib hydrochloride

Sign In for Pricing
View Details
Cerdulatinib hydrochloride
T6104-04 25 mg

Cerdulatinib hydrochloride

Sign In for Pricing
View Details
Cerdulatinib hydrochloride
T6104-05 50 mg

Cerdulatinib hydrochloride

Sign In for Pricing
View Details