Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TSEN2 Peptide - C-terminal region

TSEN2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC2776, MGC4440, PCH2B, SEN2, SEN2L

UniProt

Q8NCE0

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TSEN2 Rabbit Polyclonal Antibody (orb585328) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079541

Preservative

Lyophilized powder

AA Sequence

LRRPLSWKSLAALSRVSVNVSKELMLCYLIKPSTMTDKEMESPECMKRIK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PHBP6 Adenovirus (Human)
36543051 1.0 mL

PHBP6 Adenovirus (Human)

Sign In for Pricing
View Details
NDUFV1 ORF Vector (Human) (pORF)
31669012 1.0 µg DNA

NDUFV1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
CLCNKA Antibody - N-terminal region : FITC (ARP35132_P050-FITC)
ARP35132_P050-FITC 100 µL

CLCNKA Antibody - N-terminal region : FITC (ARP35132_P050-FITC)

Sign In for Pricing
View Details
TGFBI AAV Vector (Mouse) (CMV)
46594104 1 µg

TGFBI AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
Bexarotene
S2098-50mg 50 mg

Bexarotene

Sign In for Pricing
View Details
LIFR Human shRNA Plasmid Kit (Locus ID 3977)
TL311737 1 Kit

LIFR Human shRNA Plasmid Kit (Locus ID 3977)

Sign In for Pricing
View Details