Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBQLN4 Peptide - middle region

UBQLN4 Peptide - middle region

Product Specifications

Product Name Alternative

A1U, C1orf6, UBIN, CIP75

UniProt

Q9NRR5

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with UBQLN4 Rabbit Polyclonal Antibody (orb583535) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_064516

Preservative

Lyophilized powder

AA Sequence

TDIQEPMFSAAREQFGNNPFSSLAGNSDSSSSQPLRTENREPLPNPWSPS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Duran Bottle 2L Extra Wide Neck
BOT2114 10 / PCK

Duran Bottle 2L Extra Wide Neck

Sign In for Pricing
View Details
Voxtalisib (XL765) Analogue
C07866 5 mg

Voxtalisib (XL765) Analogue

Sign In for Pricing
View Details
CD133 Antibody
orb621428-01 50 μL

CD133 Antibody

Sign In for Pricing
View Details
CD133 Antibody
orb621428-02 100 µL

CD133 Antibody

Sign In for Pricing
View Details
Melk (Maternal Embryonic Leucine Zipper Kinase, Protein Kinase PK38, mPK38, Tyrosine-Protein Kinase MELK, Melk, Kiaa0175, Pk38) (MaxLight 490) discontinued
302555-ML490 100 µL

Melk (Maternal Embryonic Leucine Zipper Kinase, Protein Kinase PK38, mPK38, Tyrosine-Protein Kinase MELK, Melk, Kiaa0175, Pk38) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Zosurabalpin (TFA)
HY-147429A 1 Each

Zosurabalpin (TFA)

Sign In for Pricing
View Details