Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Vamp1 Peptide - C-terminal region

Vamp1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Syb1

UniProt

Q63666

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Vamp1 Rabbit Polyclonal Antibody (orb584354) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_037222

Preservative

Lyophilized powder

AA Sequence

ELDDRADALQAGASVFESSAAKLKRKYWWKNCKMMIMLGAICAIIVVVIV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tankyrase (TNKS) (N-term) Rabbit Polyclonal Antibody
AP54320PU-N 400 µL

Tankyrase (TNKS) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FITC Anti-Human CD56/NCAM Antibody[MY31]
E-AB-F1270C-01 20 Tests

FITC Anti-Human CD56/NCAM Antibody[MY31]

Sign In for Pricing
View Details
FITC Anti-Human CD56/NCAM Antibody[MY31]
E-AB-F1270C-02 100 Tests

FITC Anti-Human CD56/NCAM Antibody[MY31]

Sign In for Pricing
View Details
FITC Anti-Human CD56/NCAM Antibody[MY31]
E-AB-F1270C-03 2x 100 Tests

FITC Anti-Human CD56/NCAM Antibody[MY31]

Sign In for Pricing
View Details
C1qa Mouse Gene Knockout Kit (CRISPR)
KN502342 1 Kit

C1qa Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cathepsin L Polyclonal Antibody
AN007170L-01 25 µL

Cathepsin L Polyclonal Antibody

Sign In for Pricing
View Details