Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Zfp664 Peptide - C-terminal region

Zfp664 Peptide - C-terminal region

Product Specifications

Product Name Alternative

AW060232, D930038J03Rik, ZFOC1, Znf664

UniProt

Q4VA44

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Zfp664 Rabbit Polyclonal Antibody (orb325678) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001075219

Preservative

Lyophilized powder

AA Sequence

SSLCIHQRVHTGEKPFKCDECGKAFSQSTSLCIHQRVHTKERNHLKISVI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAB17 Antibody
23-213 100 µL

RAB17 Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal COX6B1 Antibody
NBP2-92703-0.02mL 0.02 mL

Rabbit Polyclonal COX6B1 Antibody

Sign In for Pricing
View Details
Entpd3 3'UTR Luciferase Stable Cell Line
TU204000 1.0 mL

Entpd3 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
GRIA1 Peptide
orb1236029 0.1 mg

GRIA1 Peptide

Sign In for Pricing
View Details
IGSF8 Rabbit Polyclonal Antibody (HRP)
orb2098088 100 µL

IGSF8 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Sdc1 (NM_013026) Rat Tagged ORF Clone
RR213298 10 µg

Sdc1 (NM_013026) Rat Tagged ORF Clone

Sign In for Pricing
View Details