Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IGSF8 Rabbit Polyclonal Antibody (HRP)

IGSF8 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

EWI2, PGRL, CD316, EWI-2, KCT-4, CD81P3, LIR-D1

UniProt

Q969P0

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human IGSF8

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LAVEAGAPYAERLAAGELRLGKEGTDRYRMVVGGAQAGDAGTYHCTAAEW

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

65kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_443100

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

MMP13 Rabbit Polyclonal Antibody (HRP)
orb2599053 100 µg

MMP13 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Human 14-3-3 beta (YWHAB) (NM_003404) AAV Particle
RC215940A1V 250 µL

Human 14-3-3 beta (YWHAB) (NM_003404) AAV Particle

Sign In for Pricing
View Details
Lentiviral mouse Tgm2 shRNA (UAS) - Lentiviral mouse Tgm2 shRNA (UAS) (25)
GTR15133757 1 Vial

Lentiviral mouse Tgm2 shRNA (UAS) - Lentiviral mouse Tgm2 shRNA (UAS) (25)

Sign In for Pricing
View Details
Eph receptor A2 (EPHA2) (NM_004431) Human Recombinant Protein
E45H32938M2 20 µg

Eph receptor A2 (EPHA2) (NM_004431) Human Recombinant Protein

Sign In for Pricing
View Details
RUFY1 (NM_025158) Human Over-expression Lysate
LC410873 20 µg

RUFY1 (NM_025158) Human Over-expression Lysate

Sign In for Pricing
View Details
Fission 1 (FIS1) Antibody (HRP)
abx314137-01 20 µg

Fission 1 (FIS1) Antibody (HRP)

Sign In for Pricing
View Details