Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF142 Peptide - C-terminal region

ZNF142 Peptide - C-terminal region

Product Specifications

Product Name Alternative

PHZ-49

UniProt

A8MWU9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF142 Rabbit Polyclonal Antibody (orb576734) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

NCBI Accession Number

NP_005072

Preservative

Lyophilized powder

AA Sequence

YKAKQKFQVVKHVRRHHPDQADPNQGVGKDPTTPTVHLHDVQLEDPSPPA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HRH3 Antibody (HRP)
orb47816-01 50 µg

HRH3 Antibody (HRP)

Sign In for Pricing
View Details
HRH3 Antibody (HRP)
orb47816-02 100 µg

HRH3 Antibody (HRP)

Sign In for Pricing
View Details
TXNIP Human shRNA Lentiviral Particle (Locus ID 10628)
TL308550V 500 µL Each

TXNIP Human shRNA Lentiviral Particle (Locus ID 10628)

Sign In for Pricing
View Details
CheKine™ Micro Mitochondrial complex III Activity Assay Kit
KTB1870-01 48 Tests - 48 Samples

CheKine™ Micro Mitochondrial complex III Activity Assay Kit

Sign In for Pricing
View Details
CheKine™ Micro Mitochondrial complex III Activity Assay Kit
KTB1870-02 96 Tests - 96 Samples

CheKine™ Micro Mitochondrial complex III Activity Assay Kit

Sign In for Pricing
View Details
Recombinant Ranunculus macranthus Photosystem II CP47 chlorophyll apoprotein (psbB), partial
MBS7080061 Inquire

Recombinant Ranunculus macranthus Photosystem II CP47 chlorophyll apoprotein (psbB), partial

Sign In for Pricing
View Details