Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF692 Peptide - N-terminal region

ZNF692 Peptide - N-terminal region

Product Specifications

Product Name Alternative

AREBP, FLJ20531, Zfp692

UniProt

Q9BU19

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF692 Rabbit Polyclonal Antibody (orb574536) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060335

Preservative

Lyophilized powder

AA Sequence

GGHMEQWCLLKERLGFSLHSQLAKFLLDRYTSSGCVLCAGPEPLPPKGLQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HRG Rabbit Polyclonal Antibody
TA367083 100 µL

HRG Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
5,7-Bis-(benzyloxy)-2-(4-(benzyloxy)phenyl)-4H-chromen-4-one
TRC-B410840-5MG 5 mg

5,7-Bis-(benzyloxy)-2-(4-(benzyloxy)phenyl)-4H-chromen-4-one

Sign In for Pricing
View Details
Vertical Autoclave BAVT-601-A
BAVT-601-A 1 Unit

Vertical Autoclave BAVT-601-A

Sign In for Pricing
View Details
NDE1 Rabbit Polyclonal Antibody
HA500198 100 µL

NDE1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Nandrolone-13C2 Benzoate
TRC-N315006-5MG 5 mg

Nandrolone-13C2 Benzoate

Sign In for Pricing
View Details
25-Hydroxy Vitamin D2-d6
TRC-H995822-10MG 10 mg

25-Hydroxy Vitamin D2-d6

Sign In for Pricing
View Details