Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Trp73 Peptide - N-terminal region

Trp73, transformation related protein 73, p73; Tp73; Trp73, tumor protein p73, tumor protein p73, OTTMUSP00000011258, p53-related protein, p53-like transcription factor

Product Specifications

Product Name Alternative

P73, Tp73

UniProt

Q9JJP2

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_035772

Preservative

Lyophilized powder

AA Sequence

SNMDVFHLQGMAQFNLLSSAMDQMGSRAAPASPYTPEHAASAPTHSPYAQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GLS Recombinant Protein
OPCA03299-20UG 20 µg

GLS Recombinant Protein

Sign In for Pricing
View Details
pU6-HENMT1-shRNA2-hPGK-Puro Plasmid
PVT46096 2 µg

pU6-HENMT1-shRNA2-hPGK-Puro Plasmid

Sign In for Pricing
View Details
RAC2 (189)
pro-719 5µg

RAC2 (189)

Sign In for Pricing
View Details
R2A Agar
MED1426 1 Each

R2A Agar

Sign In for Pricing
View Details
DGCR14 Protein Vector (Mouse) (pPM-C-His)
PV171801 500 ng

DGCR14 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Recombinant Mouse E3 ubiquitin-protein ligase TRIM21 Protein, His-SUMO, E.coli-200ug
QP7725-ec-200ug 200ug

Recombinant Mouse E3 ubiquitin-protein ligase TRIM21 Protein, His-SUMO, E.coli-200ug

Sign In for Pricing
View Details