Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GLS Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Glutaminase

Gene Aliases

AAD20; CASGID; DEE71; EIEE71; GAC; GAM; GDPAG; GLS1; glutaminase C; glutaminase kidney isoform, mitochondrial; glutaminase, phosphate-activated; KGA; K-glutaminase; L-glutamine amidohydrolase.

Gene ID

2744

Accession Number

NP_001243239.1

Reactivity

Homo sapiens|Human

Target

Catalyzes the first reaction in the primary pathway for the renal catabolism of glutamine. Plays a role in maintaining acid-base homeostasis. Regulates the levels of the neurotransmitter glutamate in the brain. Isoform 2 lacks catalytic activity.

Type

Protein

Source

E.coli

Sequence

KDRWNNTPMDEALHFGHHDVFKILQEYQVQYTPQGDSDNGKENQTVHKNLDGLL

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

33.3 kDa

Protein Length

Recombinant

NCBI Gene Symbol

GLS

Host or Source

Human

Protein Name

Glutaminase kidney isoform, mitochondrial

Gene Name URL

GLS

Nucleotide Accession Number

NM_001256310.1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fhl4 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
20547066 1.0 µg DNA

Fhl4 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Magic™ Membrane Protein Human DNAJC15 (DnaJ heat shock protein family (Hsp40) member C15)
MP0285J Each

Magic™ Membrane Protein Human DNAJC15 (DnaJ heat shock protein family (Hsp40) member C15)

Sign In for Pricing
View Details
Box of 100 very slow qualitative filter, 240 mm
QL08A0240 Box of 100

Box of 100 very slow qualitative filter, 240 mm

Sign In for Pricing
View Details
Pdk4, NT (Pdk4, [Pyruvate dehydrogenase [lipoamide]] kinase isozyme 4, mitochondrial, Pyruvate dehydrogenase kinase isoform 4) (MaxLight 550) discontinued
039849-ML550 100 µL

Pdk4, NT (Pdk4, [Pyruvate dehydrogenase [lipoamide]] kinase isozyme 4, mitochondrial, Pyruvate dehydrogenase kinase isoform 4) (MaxLight 550) discontinued

Sign In for Pricing
View Details
TRNAP22P CRISPRa sgRNA lentivector (set of three targets)(Human)
48264121 3x 1.0µg DNA

TRNAP22P CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
Rat Shtn1 Pre-designed siRNA Set A
SI212854A 1 Each

Rat Shtn1 Pre-designed siRNA Set A

Sign In for Pricing
View Details