Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ppic Peptide - middle region

Ppic Peptide - middle region

Product Specifications

Product Name Alternative

CyP-20c

UniProt

P30412

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ppic Rabbit Polyclonal Antibody (orb579147) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_032934

Preservative

Lyophilized powder

AA Sequence

VVFGKVLDGMTVVHSIELQATDGHDRPLTDCTIVNSGKIDVKTPFVVEVP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-EURL Antibody Picoband® Biotin Conjugated
A11536-1-Biotin 100 µg/Vial

Anti-EURL Antibody Picoband® Biotin Conjugated

Sign In for Pricing
View Details
TLK1 Rabbit Polyclonal Antibody (FITC)
orb2100195 100 µL

TLK1 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Curdlan
T40626 200 mg

Curdlan

Sign In for Pricing
View Details
Runx1/AML1-ETO polyclonal antibody
6829-50 50 µL

Runx1/AML1-ETO polyclonal antibody

Sign In for Pricing
View Details
Anti-Mesothelin/Msln Antibody Picoband® Fluoro594 Conjugated
A03266-1-Fluoro594 100 µg/Vial

Anti-Mesothelin/Msln Antibody Picoband® Fluoro594 Conjugated

Sign In for Pricing
View Details
Human Interleukin-9 receptor (IL9R) ELISA Kit
MBS284253-01 48 Tests

Human Interleukin-9 receptor (IL9R) ELISA Kit

Sign In for Pricing
View Details