Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NDUFB10 Peptide - C-terminal region

NDUFB10 Peptide - C-terminal region

Product Specifications

Product Name Alternative

PDSW

UniProt

O96000

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NDUFB10 Rabbit Polyclonal Antibody (orb585455) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_004539

Preservative

Lyophilized powder

AA Sequence

KVDQEIINIMQDRLKACQQREGQNYQQNCIKEVEQFTQVAKAYQDRYQDL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant MESDC2 Monoclonal Antibody
AN300356P 100 µL

Recombinant MESDC2 Monoclonal Antibody

Sign In for Pricing
View Details
Human HDX activation kit by CRISPRa
GA115336 1 Kit

Human HDX activation kit by CRISPRa

Sign In for Pricing
View Details
Bis(2,5-dioxopyrrolidin-1-yl) succinate
TRC-B016172-250MG 250 mg

Bis(2,5-dioxopyrrolidin-1-yl) succinate

Sign In for Pricing
View Details
dUTPase Recombinant Rabbit Monoclonal Antibody [JE66-11]
HA721389 100 µL

dUTPase Recombinant Rabbit Monoclonal Antibody [JE66-11]

Sign In for Pricing
View Details
Human ZNF526 activation kit by CRISPRa
GA114565 1 Kit

Human ZNF526 activation kit by CRISPRa

Sign In for Pricing
View Details
ODC1 Antibody
KC-3183-01 50 μL

ODC1 Antibody

Sign In for Pricing
View Details