Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TAZ Peptide - middle region

TAZ Peptide - middle region

Product Specifications

Product Name Alternative

BTHS, CMD3A, EFE, EFE2, FLJ27390, G4.5, LVNCX, Taz1, XAP-2

UniProt

Q16635

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TAZ Rabbit Polyclonal Antibody (orb331226) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_851828

Preservative

Lyophilized powder

AA Sequence

PNSPPYFPRFGQKITVLIGKPFSALPVLERLRAENKSAVEMRKALTDFIQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD112 Rabbit pAb
A23657-01 20 µL

CD112 Rabbit pAb

Sign In for Pricing
View Details
CD112 Rabbit pAb
A23657-02 100 μL

CD112 Rabbit pAb

Sign In for Pricing
View Details
CD112 Rabbit pAb
A23657-03 500 μL

CD112 Rabbit pAb

Sign In for Pricing
View Details
CD112 Rabbit pAb
A23657-04 1000 μL

CD112 Rabbit pAb

Sign In for Pricing
View Details
RIPK1 Polyclonal Antibody, PE-Cy5 Conjugated
bs-5805R-PE-Cy5-TR 20 µL

RIPK1 Polyclonal Antibody, PE-Cy5 Conjugated

Sign In for Pricing
View Details
Mouse anti Human CD15
0151 100 µg

Mouse anti Human CD15

Sign In for Pricing
View Details