Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DMC1 Peptide - N-terminal region

DMC1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DMC1H, HsLim15, LIM15, MGC150472, MGC150473, dJ199H16.1

UniProt

Q14565

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DMC1 Rabbit Polyclonal Antibody (orb585629) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_008999

Preservative

Lyophilized powder

AA Sequence

GIQMTTRRALCNVKGLSEAKVDKIKEAANKLIEPGFLTAFEYSEKRKMVF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Apolipoprotein B/Apo B Recombinant Rabbit monoclonal Antibody
HA723946 100 µL

Mouse Apolipoprotein B/Apo B Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
EIF1 Human Gene Knockout Kit (CRISPR)
KN401271 1 Kit

EIF1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Giardia intestinalis TaqMan Probe/Primer and Control Set
TM43810 100 Reactions

Giardia intestinalis TaqMan Probe/Primer and Control Set

Sign In for Pricing
View Details
SIRT5 Human Gene Knockout Kit (CRISPR)
KN400189 1 Kit

SIRT5 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
5beta-Dihydrocortisol
TRC-D448595-25MG 25 mg

5beta-Dihydrocortisol

Sign In for Pricing
View Details
BAY 11-7082
SIH-434-10MG 10 mg

BAY 11-7082

Sign In for Pricing
View Details