Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TOR1A Peptide - C-terminal region

TOR1A Peptide - C-terminal region

Product Specifications

Product Name Alternative

DQ2, DYT1

UniProt

O14656

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TOR1A Rabbit Polyclonal Antibody (orb585630) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000104

Preservative

Lyophilized powder

AA Sequence

AMFIFLSNAGAERITDVALDFWRSGKQREDIKLKDIEHALSVSVFNNKNS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPAR gamma (PPARG) (NM_015869) Human Recombinant Protein
PH36598M5 20 µg

PPAR gamma (PPARG) (NM_015869) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant Streptococcus pneumoniae 3-phosphoshikimate 1-carboxyvinyltransferase (aroA)
MBS1109198-01 0.02 mg (E-Coli)

Recombinant Streptococcus pneumoniae 3-phosphoshikimate 1-carboxyvinyltransferase (aroA)

Sign In for Pricing
View Details
Recombinant Streptococcus pneumoniae 3-phosphoshikimate 1-carboxyvinyltransferase (aroA)
MBS1109198-02 0.02 mg (Yeast)

Recombinant Streptococcus pneumoniae 3-phosphoshikimate 1-carboxyvinyltransferase (aroA)

Sign In for Pricing
View Details
Recombinant Streptococcus pneumoniae 3-phosphoshikimate 1-carboxyvinyltransferase (aroA)
MBS1109198-03 0.1 mg (E-Coli)

Recombinant Streptococcus pneumoniae 3-phosphoshikimate 1-carboxyvinyltransferase (aroA)

Sign In for Pricing
View Details
Recombinant Streptococcus pneumoniae 3-phosphoshikimate 1-carboxyvinyltransferase (aroA)
MBS1109198-04 0.1 mg (Yeast)

Recombinant Streptococcus pneumoniae 3-phosphoshikimate 1-carboxyvinyltransferase (aroA)

Sign In for Pricing
View Details
Recombinant Streptococcus pneumoniae 3-phosphoshikimate 1-carboxyvinyltransferase (aroA)
MBS1109198-05 0.02 mg (Baculovirus)

Recombinant Streptococcus pneumoniae 3-phosphoshikimate 1-carboxyvinyltransferase (aroA)

Sign In for Pricing
View Details