Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD2 Peptide - C-terminal region

CD2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ46032, SRBC, T11

UniProt

P06729

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CD2 Rabbit Polyclonal Antibody (orb585488) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001758

Preservative

Lyophilized powder

AA Sequence

TTSLSAKFKCTAGNKVSKESSVEPVSCPEKGLDIYLIIGICGGGSLLMVF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human ILT6/LILRA3 protein (His tag)
PDMH100137-01 20 µg

Recombinant Human ILT6/LILRA3 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human ILT6/LILRA3 protein (His tag)
PDMH100137-02 100 µg

Recombinant Human ILT6/LILRA3 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human ILT6/LILRA3 protein (His tag)
PDMH100137-03 500 µg

Recombinant Human ILT6/LILRA3 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human ILT6/LILRA3 protein (His tag)
PDMH100137-04 1 mg

Recombinant Human ILT6/LILRA3 protein (His tag)

Sign In for Pricing
View Details
MTF1 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
30879154 3x 1.0 µg DNA

MTF1 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
Equine Herpesvirus 1 (Internal control) Real Time PCR Detection Kit
GZE004 8 Tests/Kit

Equine Herpesvirus 1 (Internal control) Real Time PCR Detection Kit

Sign In for Pricing
View Details