Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD68 Peptide - N-terminal region

CD68 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DKFZp686M18236, GP110, SCARD1, LAMP4

UniProt

P34810

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CD68 Rabbit Polyclonal Antibody (orb585500) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001242

Preservative

Lyophilized powder

AA Sequence

LLAAQGTGNDCPHKKSATLLPSFTVTPTVTESTGTTSHRTTKSHKTTTHR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P63 (Squamous, Basal & Myoepithelial Cell Marker) (TP63/2427), CF640R conjugate, 0.1mg/mL
BNC402427-100 1x 100 µL

P63 (Squamous, Basal & Myoepithelial Cell Marker) (TP63/2427), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
General Purpose Incubator BIGP-6908
BIGP-6908 1 Unit

General Purpose Incubator BIGP-6908

Sign In for Pricing
View Details
Amplite® Fluorimetric Lithium Ion Quantification Kit
21351-AAT 100 Tests

Amplite® Fluorimetric Lithium Ion Quantification Kit

Sign In for Pricing
View Details
Mouse Legumain (LGMN) ELISA Kit
RDR-LGMN-Mu-01 96 Tests

Mouse Legumain (LGMN) ELISA Kit

Sign In for Pricing
View Details
Mouse Legumain (LGMN) ELISA Kit
RDR-LGMN-Mu-02 48 Tests

Mouse Legumain (LGMN) ELISA Kit

Sign In for Pricing
View Details
PCSK9 Recombinant Rabbit Monoclonal Antibody [JE30-37]
HA722528 100 µL

PCSK9 Recombinant Rabbit Monoclonal Antibody [JE30-37]

Sign In for Pricing
View Details