Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMEM63A Peptide - C-terminal region

TMEM63A Peptide - C-terminal region

Product Specifications

Product Name Alternative

KIAA0489, KIAA0792

UniProt

O94886

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TMEM63A Rabbit Polyclonal Antibody (orb324899) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055513

Preservative

Lyophilized powder

AA Sequence

FLVLLLTILVCLAHTCFGCFKHLSPLNYKTEEPASDKGSEAEAHMPPPFT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RASSF1 Rabbit Polyclonal Antibody (HRP)
orb2098406 100 µL

RASSF1 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Trans-3-Hydroxyproline
166859 100 mg

Trans-3-Hydroxyproline

Sign In for Pricing
View Details
D1Pas1 (NM_033077) Mouse Tagged ORF Clone Lentiviral Particle
MR226486L3V 200 µL

D1Pas1 (NM_033077) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Human ANKRD55 activation kit by CRISPRa
GA112576 1 Kit

Human ANKRD55 activation kit by CRISPRa

Sign In for Pricing
View Details
Fgb Rat shRNA Lentiviral Particle (Locus ID 24366)
TL710389V 500 µL Each

Fgb Rat shRNA Lentiviral Particle (Locus ID 24366)

Sign In for Pricing
View Details
Magic™ Membrane Protein Human GRM2 (Glutamate metabotropic receptor 2) for Antibody Discovery
MP0495X Each

Magic™ Membrane Protein Human GRM2 (Glutamate metabotropic receptor 2) for Antibody Discovery

Sign In for Pricing
View Details